$100.00
Legal Disclaimer
This information has not been reviewed or endorsed by the US FDA. It is provided solely for educational and research purposes. LL-37 is not approved for medical use, human consumption, or as a therapeutic treatment in this context.
Product Details
Quantity: 5mg per vial
Packaging: Secure, sealed, and tamper-proof vials
Source: High-quality lab-grade peptide, third-party tested
Note: This product is sold in powder form and must be reconstituted before use
Overview of LL-37’s Research Profile
LL-37 is a cationic antimicrobial peptide belonging to the cathelicidin family. It has been extensively studied for its ability to disrupt microbial membranes, regulate immune signaling, and support wound-healing processes in controlled laboratory models.
Researchers are particularly interested in LL-37’s dual activity: direct antimicrobial action against bacteria and fungi, and indirect immunomodulatory effects through cytokine regulation and tissue repair pathways.
Research Specifics
LL-37 demonstrates efficacy in several areas of research:
Antimicrobial Effects: Disrupts bacterial membranes via amphipathic insertion.
Immune Modulation: Influences cytokine signaling and host defense regulation.
Wound Healing Models: Supports angiogenesis, collagen synthesis, and tissue remodeling.
Inflammatory Studies: Evaluated for its role in immune balance and inflammation resolution.
Key Features
Amino Acid Sequence: [LL-37, 37 aa]
Molecular Weight: ~4.5 kDa
Purity: ≥98% lab-grade peptide, HPLC verified
Form: Lyophilized powder for reconstitution
Potential Applications
Researchers are exploring LL-37’s role in:
Host-pathogen interaction models
Antimicrobial resistance studies
Tissue regeneration and wound closure research
Immune modulation pathway investigations
Specifications
This product is packaged securely in a sterile, tamper-proof vial to ensure stability. It must be reconstituted prior to laboratory use according to research protocols.
Reviews
There are no reviews yet.